Record in detail


General Info

  • lamp_id:L13A010829
  • Name:
  • FullName:
  • Source:
  • Mass:4957.8 Da
  • Sequence Length:50 aa
  • Isoelectric Point:7.55
  • Activity:antimicrobial
  • Sequence
        LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIV
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:SATPdb  satpdb10829

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08016|    From 3 To 52 E-value: 1e-21 Score: 93.2
        LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIV
  • 2. L02A001652    From 1 To 50 E-value: 2e-21 Score: 92.8
        LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIV
  • 3. L13A010829    From 1 To 50 E-value: 2e-21 Score: 92.8
        LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIV
  • 4. L12A06081|    From 1 To 50 E-value: 0.00000000000006 Score: 67.8
        LVNQLGISKSLANTILGAIAVGNLASWVLALVPGPGWATKAALATAETIV
  • 5. L04ABAC209    From 3 To 52 E-value: 0.0000000000001 Score: 67
        LVNQLGISKSLANTILGAIAVGNLASWLLALVPGPGWATKAALATAETIV
  • 6. L12A08016|    From 3 To 52 E-value: 1e-21 Score: 93.2
        LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIV
  • 7. L02A001652    From 1 To 50 E-value: 2e-21 Score: 92.8
        LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIV
  • 8. L13A010829    From 1 To 50 E-value: 2e-21 Score: 92.8
        LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIV
  • 9. L12A06081|    From 1 To 50 E-value: 0.00000000000006 Score: 67.8
        LVNQLGISKSLANTILGAIAVGNLASWVLALVPGPGWATKAALATAETIV
  • 10. L04ABAC209    From 3 To 52 E-value: 0.0000000000001 Score: 67
        LVNQLGISKSLANTILGAIAVGNLASWLLALVPGPGWATKAALATAETIV

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: