Record in detail


General Info

  • lamp_id:L13A011347
  • Name:
  • FullName:
  • Source:
  • Mass:4035.4 Da
  • Sequence Length:35 aa
  • Isoelectric Point:4.05
  • Activity:antiviral,antimicrobial
  • Sequence
        NFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSD
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:avpdb  AVP0129
  •   2  Database:SATPdb  satpdb11347

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A011347    From 1 To 35 E-value: 0.000000000000005 Score: 71.6
        NFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSD
  • 2. L13A017841    From 2 To 35 E-value: 0.00000000000002 Score: 69.7
        NFYDPLVFPSDEFDASISQVNEKINQSLAFIRKS
  • 3. L13A010057    From 1 To 34 E-value: 0.00000000000002 Score: 69.7
        FYDPLVFPSDEFDASISQVNEKINQSLAFIRKSD
  • 4. L13A017921    From 1 To 35 E-value: 0.00000000000002 Score: 69.3
        NFYDPLVFPSDEFDASISQVNEKINQSLASIRKSD
  • 5. L13A026368    From 3 To 35 E-value: 0.00000000000005 Score: 68.2
        NFYDPLVFPSDEFDASISQVNEKINQSLAFIRK
  • 6. L13A011347    From 1 To 35 E-value: 0.000000000000005 Score: 71.6
        NFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSD
  • 7. L13A017841    From 2 To 35 E-value: 0.00000000000002 Score: 69.7
        NFYDPLVFPSDEFDASISQVNEKINQSLAFIRKS
  • 8. L13A010057    From 1 To 34 E-value: 0.00000000000002 Score: 69.7
        FYDPLVFPSDEFDASISQVNEKINQSLAFIRKSD
  • 9. L13A017921    From 1 To 35 E-value: 0.00000000000002 Score: 69.3
        NFYDPLVFPSDEFDASISQVNEKINQSLASIRKSD
  • 10. L13A026368    From 3 To 35 E-value: 0.00000000000005 Score: 68.2
        NFYDPLVFPSDEFDASISQVNEKINQSLAFIRK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: