Record in detail
General Info
- lamp_id:L13A011591
- Name:
- FullName:
- Source:
- Mass:4479.9 Da
- Sequence Length:39 aa
- Isoelectric Point:4.17
- Activity:antiviral,antimicrobial
- Sequence
YDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNV - Function:
Cross-Linking
- Cross-linking
- 1 Database:avpdb AVP1581
- 2 Database:SATPdb satpdb11591
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L13A011591 From 1 To 39 E-value: 1e-17 Score: 80.1
YDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNV - 2. L13A017921 From 3 To 41 E-value: 9e-17 Score: 77.4
YDPLVFPSDEFDASISQVNEKINQSLASIRKSDELLHNV - 3. L13A022296 From 1 To 35 E-value: 0.000000000000004 Score: 71.6
YDPLVFPSDEFDASISQVNEKINQSLAFIRKSDEL - 4. L13A012096 From 1 To 35 E-value: 0.000000000000004 Score: 71.6
PLVFPSDEFDASISQVNEKINQSLAFIRKSDELLH - 5. L13A020524 From 1 To 35 E-value: 0.000000000000006 Score: 71.2
VFPSDEFDASISQVNEKINQSLAFIRKSDELLHNV - 6. L13A011591 From 1 To 39 E-value: 1e-17 Score: 80.1
YDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNV - 7. L13A017921 From 3 To 41 E-value: 9e-17 Score: 77.4
YDPLVFPSDEFDASISQVNEKINQSLASIRKSDELLHNV - 8. L13A022296 From 1 To 35 E-value: 0.000000000000004 Score: 71.6
YDPLVFPSDEFDASISQVNEKINQSLAFIRKSDEL - 9. L13A012096 From 1 To 35 E-value: 0.000000000000004 Score: 71.6
PLVFPSDEFDASISQVNEKINQSLAFIRKSDELLH - 10. L13A020524 From 1 To 35 E-value: 0.000000000000006 Score: 71.2
VFPSDEFDASISQVNEKINQSLAFIRKSDELLHNV
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database