Record in detail
General Info
- lamp_id:L13A012291
- Name:
- FullName:
- Source:
- Mass:4425.2 Da
- Sequence Length:37 aa
- Isoelectric Point:11.35
- Activity:antiviral,antimicrobial
- Sequence
LLGDLLRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES - Function:
Cross-Linking
- Cross-linking
- 1 Database:DBAASP 140
- 2 Database:dbAMP dbAMP_05840
- 3 Database:HIPdb HIP899
- 4 Database:SATPdb satpdb12291
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L13A012291 From 1 To 37 E-value: 0.000000000000002 Score: 72.4
LLGDLLRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES - 2. L11A011557 From 1 To 37 E-value: 0.000000000000008 Score: 70.9
[LL-37, 37 aa] - 3. L12A11486| From 22 To 58 E-value: 0.000000000000008 Score: 70.9
[LL-37, 37 aa] - 4. L01A003954 From 3 To 39 E-value: 0.00000000000001 Score: 70.5
[LL-37, 37 aa] - 5. L02A000624 From 2 To 38 E-value: 0.00000000000001 Score: 70.5
[LL-37, 37 aa] - 6. L13A012291 From 1 To 37 E-value: 0.000000000000002 Score: 72.4
LLGDLLRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES - 7. L11A011557 From 1 To 37 E-value: 0.000000000000008 Score: 70.9
[LL-37, 37 aa] - 8. L12A11486| From 22 To 58 E-value: 0.000000000000008 Score: 70.9
[LL-37, 37 aa] - 9. L01A003954 From 3 To 39 E-value: 0.00000000000001 Score: 70.5
[LL-37, 37 aa] - 10. L02A000624 From 2 To 38 E-value: 0.00000000000001 Score: 70.5
[LL-37, 37 aa]
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database