Record in detail


General Info

  • lamp_id:L13A014321
  • Name:
  • FullName:
  • Source:
  • Mass:4104.6 Da
  • Sequence Length:36 aa
  • Isoelectric Point:4.6
  • Activity:antiviral,antimicrobial
  • Sequence
        VYTDKVDISSQISSMNQSLQQSKDYIKEAQKILDTV
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A014321    From 1 To 36 E-value: 0.00000000000002 Score: 69.7
        VYTDKVDISSQISSMNQSLQQSKDYIKEAQKILDTV
  • 2. L13A010313    From 3 To 38 E-value: 0.0000000000004 Score: 65.1
        VYTKDVDISSQISSMNQSLQQSKDYIKEAQKILDTV
  • 3. L13A016389    From 1 To 32 E-value: 0.00000000001 Score: 60.1
        KVDISSQISSMNQSLQQSKDYIKEAQRLLDTV
  • 4. L13A027781    From 1 To 36 E-value: 0.047 Score: 28.5
        VANDPIDISIELNKAKSDLEESKEWIRRSNQKLDSI
  • 5. L13A016394    From 8 To 43 E-value: 0.07 Score: 27.7
        VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDSI
  • 6. L13A014321    From 1 To 36 E-value: 0.00000000000002 Score: 69.7
        VYTDKVDISSQISSMNQSLQQSKDYIKEAQKILDTV
  • 7. L13A010313    From 3 To 38 E-value: 0.0000000000004 Score: 65.1
        VYTKDVDISSQISSMNQSLQQSKDYIKEAQKILDTV
  • 8. L13A016389    From 1 To 32 E-value: 0.00000000001 Score: 60.1
        KVDISSQISSMNQSLQQSKDYIKEAQRLLDTV
  • 9. L13A027781    From 1 To 36 E-value: 0.047 Score: 28.5
        VANDPIDISIELNKAKSDLEESKEWIRRSNQKLDSI
  • 10. L13A016394    From 8 To 43 E-value: 0.07 Score: 27.7
        VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDSI

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: