Record in detail


General Info

  • lamp_id:L13A015099
  • Name:
  • FullName:
  • Source:
  • Mass:5997.2 Da
  • Sequence Length:50 aa
  • Isoelectric Point:13.05
  • Activity:antimicrobial
  • Sequence
        RRLRPRHQHFPSERPWPKPLPLPLPRPGPRPWPKPLPLPLPRPGLRPWPK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:SATPdb  satpdb15099

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A015099    From 1 To 50 E-value: 5e-19 Score: 84.7
        RRLRPRHQHFPSERPWPKPLPLPLPRPGPRPWPKPLPLPLPRPGLRPWPK
  • 2. L02A001288    From 1 To 20 E-value: 0.004 Score: 32
        RRLHPQHQRFPRERPWPKPL
  • 3. L13A014078    From 1 To 20 E-value: 0.004 Score: 32
        RRLHPQHQRFPRERPWPKPL
  • 4. L02A000682    From 1 To 13 E-value: 0.04 Score: 28.5
        RRLRPRHQHFPSE
  • 5. L13A015099    From 1 To 50 E-value: 5e-19 Score: 84.7
        RRLRPRHQHFPSERPWPKPLPLPLPRPGPRPWPKPLPLPLPRPGLRPWPK
  • 6. L02A001288    From 1 To 20 E-value: 0.004 Score: 32
        RRLHPQHQRFPRERPWPKPL
  • 7. L13A014078    From 1 To 20 E-value: 0.004 Score: 32
        RRLHPQHQRFPRERPWPKPL
  • 8. L02A000682    From 1 To 13 E-value: 0.04 Score: 28.5
        RRLRPRHQHFPSE

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: