Record in detail


General Info

  • lamp_id:L13A015273
  • Name:
  • FullName:
  • Source:
  • Mass:3930.3 Da
  • Sequence Length:35 aa
  • Isoelectric Point:4.35
  • Activity:antiviral,antimicrobial
  • Sequence
        PSDEFDASISQVNEKINQSLAFIRKSDELLHNVNA
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A015273    From 1 To 35 E-value: 0.000000000000006 Score: 71.2
        PSDEFDASISQVNEKINQSLAFIRKSDELLHNVNA
  • 2. L13A018521    From 2 To 35 E-value: 0.00000000000002 Score: 69.3
        PSDEFDASISQVNEKINQSLAFIRKSDELLHNVN
  • 3. L13A023532    From 1 To 34 E-value: 0.00000000000004 Score: 68.2
        SDEFDASISQVNEKINQSLAFIRKSDELLHNVNA
  • 4. L13A020524    From 3 To 35 E-value: 0.00000000000007 Score: 67.8
        PSDEFDASISQVNEKINQSLAFIRKSDELLHNV
  • 5. L13A011591    From 7 To 39 E-value: 0.00000000000007 Score: 67.4
        PSDEFDASISQVNEKINQSLAFIRKSDELLHNV
  • 6. L13A015273    From 1 To 35 E-value: 0.000000000000006 Score: 71.2
        PSDEFDASISQVNEKINQSLAFIRKSDELLHNVNA
  • 7. L13A018521    From 2 To 35 E-value: 0.00000000000002 Score: 69.3
        PSDEFDASISQVNEKINQSLAFIRKSDELLHNVN
  • 8. L13A023532    From 1 To 34 E-value: 0.00000000000004 Score: 68.2
        SDEFDASISQVNEKINQSLAFIRKSDELLHNVNA
  • 9. L13A020524    From 3 To 35 E-value: 0.00000000000007 Score: 67.8
        PSDEFDASISQVNEKINQSLAFIRKSDELLHNV
  • 10. L13A011591    From 7 To 39 E-value: 0.00000000000007 Score: 67.4
        PSDEFDASISQVNEKINQSLAFIRKSDELLHNV

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: