Record in detail


General Info

  • lamp_id:L13A015674
  • Name:
  • FullName:
  • Source:
  • Mass:3927.3 Da
  • Sequence Length:34 aa
  • Isoelectric Point:4.83
  • Activity:antiviral,antimicrobial
  • Sequence
        NSVALDPIDISIELNKAKSDLEESKEWIRRSNQK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A016394    From 6 To 39 E-value: 0.00000000000008 Score: 67.4
        NSVALDPIDISIELNKAKSDLEESKEWIRRSNQK
  • 2. L01A003938    From 1 To 34 E-value: 0.00000000000008 Score: 67.4
        NSVALDPIDISIELNKAKSDLEESKEWIRRSNQK
  • 3. L13A015674    From 1 To 34 E-value: 0.00000000000009 Score: 67.4
        NSVALDPIDISIELNKAKSDLEESKEWIRRSNQK
  • 4. L01A003939    From 2 To 35 E-value: 0.00000000000009 Score: 67.4
        NSVALDPIDISIELNKAKSDLEESKEWIRRSNQK
  • 5. L01A003940    From 3 To 35 E-value: 0.0000000000003 Score: 65.9
        NSVALDPIDISIELNKAKSDLEESKEWIRRSNQ
  • 6. L13A016394    From 6 To 39 E-value: 0.00000000000008 Score: 67.4
        NSVALDPIDISIELNKAKSDLEESKEWIRRSNQK
  • 7. L01A003938    From 1 To 34 E-value: 0.00000000000008 Score: 67.4
        NSVALDPIDISIELNKAKSDLEESKEWIRRSNQK
  • 8. L13A015674    From 1 To 34 E-value: 0.00000000000009 Score: 67.4
        NSVALDPIDISIELNKAKSDLEESKEWIRRSNQK
  • 9. L01A003939    From 2 To 35 E-value: 0.00000000000009 Score: 67.4
        NSVALDPIDISIELNKAKSDLEESKEWIRRSNQK
  • 10. L01A003940    From 3 To 35 E-value: 0.0000000000003 Score: 65.9
        NSVALDPIDISIELNKAKSDLEESKEWIRRSNQ

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: