Record in detail
General Info
- lamp_id:L13A016095
- Name:
- FullName:
- Source:
- Mass:4286.9 Da
- Sequence Length:36 aa
- Isoelectric Point:9.81
- Activity:antiviral,antimicrobial
- Sequence
RQIKINFQNRRMKNKKGELDELVYLLDGPGYDPIHS - Function:
Cross-Linking
- Cross-linking
- 1 Database:avpdb AVP1222
- 2 Database:SATPdb satpdb16095
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L13A016095 From 1 To 36 E-value: 2e-16 Score: 76.3
RQIKINFQNRRMKNKKGELDELVYLLDGPGYDPIHS - 2. L13A025248 From 1 To 20 E-value: 0.0000007 Score: 44.3
GELDELVYLLDGPGYDPIHS - 3. L13A012543 From 1 To 20 E-value: 0.000001 Score: 43.9
GELDELVYLLDGPGYDPIHC - 4. L13A015258 From 1 To 20 E-value: 0.00002 Score: 39.3
GELGRLVYLLDGPGYDPIHC - 5. L13A019607 From 1 To 20 E-value: 0.00003 Score: 39.3
GELGRLVYLLDGPGYDPIHC - 6. L13A016095 From 1 To 36 E-value: 2e-16 Score: 76.3
RQIKINFQNRRMKNKKGELDELVYLLDGPGYDPIHS - 7. L13A025248 From 1 To 20 E-value: 0.0000007 Score: 44.3
GELDELVYLLDGPGYDPIHS - 8. L13A012543 From 1 To 20 E-value: 0.000001 Score: 43.9
GELDELVYLLDGPGYDPIHC - 9. L13A015258 From 1 To 20 E-value: 0.00002 Score: 39.3
GELGRLVYLLDGPGYDPIHC - 10. L13A019607 From 1 To 20 E-value: 0.00003 Score: 39.3
GELGRLVYLLDGPGYDPIHC
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database