Record in detail
General Info
- lamp_id:L13A016210
- Name:
- FullName:
- Source:
- Mass:3399.9 Da
- Sequence Length:30 aa
- Isoelectric Point:10.34
- Activity:anticancer,antibacterial,antimicrobial
- Sequence
PDEDAINNALNKVCSTGRRQRSICKQLLKK - Function:
Cross-Linking
- Cross-linking
- 1 Database:cancerppd 3102
- 2 Database:SATPdb satpdb16210
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L13A016210 From 1 To 30 E-value: 0.000000000002 Score: 62.8
PDEDAINNALNKVCSTGRRQRSICKQLLKK - 2. L13A016586 From 1 To 30 E-value: 0.000000000006 Score: 61.2
PDEDAINDALNKVCSTGRRQRSICKQLLKK - 3. L12A03971| From 21 To 51 E-value: 0.014 Score: 30
PTQRSVSNAATRVCRTGRSRWRDVCRNFMRR - 4. L12A03970| From 21 To 51 E-value: 0.014 Score: 30
PTQRSVSNAATRVCRTGRSRWRDVCRNFMRR - 5. L12A03972| From 21 To 51 E-value: 0.016 Score: 30
PTQRSVSNAATRVCRTGRSRWRDVCRNFMRR - 6. L13A016210 From 1 To 30 E-value: 0.000000000002 Score: 62.8
PDEDAINNALNKVCSTGRRQRSICKQLLKK - 7. L13A016586 From 1 To 30 E-value: 0.000000000006 Score: 61.2
PDEDAINDALNKVCSTGRRQRSICKQLLKK - 8. L12A03971| From 21 To 51 E-value: 0.014 Score: 30
PTQRSVSNAATRVCRTGRSRWRDVCRNFMRR - 9. L12A03970| From 21 To 51 E-value: 0.014 Score: 30
PTQRSVSNAATRVCRTGRSRWRDVCRNFMRR - 10. L12A03972| From 21 To 51 E-value: 0.016 Score: 30
PTQRSVSNAATRVCRTGRSRWRDVCRNFMRR
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database