Record in detail


General Info

  • lamp_id:L13A016210
  • Name:
  • FullName:
  • Source:
  • Mass:3399.9 Da
  • Sequence Length:30 aa
  • Isoelectric Point:10.34
  • Activity:anticancer,antibacterial,antimicrobial
  • Sequence
        PDEDAINNALNKVCSTGRRQRSICKQLLKK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:cancerppd  3102
  •   2  Database:SATPdb  satpdb16210

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A016210    From 1 To 30 E-value: 0.000000000002 Score: 62.8
        PDEDAINNALNKVCSTGRRQRSICKQLLKK
  • 2. L13A016586    From 1 To 30 E-value: 0.000000000006 Score: 61.2
        PDEDAINDALNKVCSTGRRQRSICKQLLKK
  • 3. L12A03971|    From 21 To 51 E-value: 0.014 Score: 30
        PTQRSVSNAATRVCRTGRSRWRDVCRNFMRR
  • 4. L12A03970|    From 21 To 51 E-value: 0.014 Score: 30
        PTQRSVSNAATRVCRTGRSRWRDVCRNFMRR
  • 5. L12A03972|    From 21 To 51 E-value: 0.016 Score: 30
        PTQRSVSNAATRVCRTGRSRWRDVCRNFMRR
  • 6. L13A016210    From 1 To 30 E-value: 0.000000000002 Score: 62.8
        PDEDAINNALNKVCSTGRRQRSICKQLLKK
  • 7. L13A016586    From 1 To 30 E-value: 0.000000000006 Score: 61.2
        PDEDAINDALNKVCSTGRRQRSICKQLLKK
  • 8. L12A03971|    From 21 To 51 E-value: 0.014 Score: 30
        PTQRSVSNAATRVCRTGRSRWRDVCRNFMRR
  • 9. L12A03970|    From 21 To 51 E-value: 0.014 Score: 30
        PTQRSVSNAATRVCRTGRSRWRDVCRNFMRR
  • 10. L12A03972|    From 21 To 51 E-value: 0.016 Score: 30
        PTQRSVSNAATRVCRTGRSRWRDVCRNFMRR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: