Record in detail


General Info

  • lamp_id:L13A016389
  • Name:
  • FullName:
  • Source:
  • Mass:4065.5 Da
  • Sequence Length:36 aa
  • Isoelectric Point:6.62
  • Activity:antiviral,antimicrobial
  • Sequence
        KVDISSQISSMNQSLQQSKDYIKEAQRLLDTVNPSL
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A016389    From 1 To 36 E-value: 0.000000000000006 Score: 71.2
        KVDISSQISSMNQSLQQSKDYIKEAQRLLDTVNPSL
  • 2. L13A010313    From 8 To 42 E-value: 0.0000000000001 Score: 66.6
        VDISSQISSMNQSLQQSKDYIKEAQKILDTVNPSL
  • 3. L13A014321    From 5 To 36 E-value: 0.00000000001 Score: 60.1
        KVDISSQISSMNQSLQQSKDYIKEAQKILDTV
  • 4. L13A016604    From 1 To 23 E-value: 0.13 Score: 26.9
        DLSNQINSINKSLKSAEDWIADS
  • 5. L01A003932    From 2 To 32 E-value: 0.39 Score: 25.4
        IDISIELNKAKSDLEESKEWIRRSNQKLDSI
  • 6. L13A016389    From 1 To 36 E-value: 0.000000000000006 Score: 71.2
        KVDISSQISSMNQSLQQSKDYIKEAQRLLDTVNPSL
  • 7. L13A010313    From 8 To 42 E-value: 0.0000000000001 Score: 66.6
        VDISSQISSMNQSLQQSKDYIKEAQKILDTVNPSL
  • 8. L13A014321    From 5 To 36 E-value: 0.00000000001 Score: 60.1
        KVDISSQISSMNQSLQQSKDYIKEAQKILDTV
  • 9. L13A016604    From 1 To 23 E-value: 0.13 Score: 26.9
        DLSNQINSINKSLKSAEDWIADS
  • 10. L01A003932    From 2 To 32 E-value: 0.39 Score: 25.4
        IDISIELNKAKSDLEESKEWIRRSNQKLDSI

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: