Record in detail


General Info

  • lamp_id:L13A016626
  • Name:
  • FullName:
  • Source:
  • Mass:4203 Da
  • Sequence Length:36 aa
  • Isoelectric Point:11.94
  • Activity:antimicrobial,antifungal
  • Sequence
        MLWSASMRIFASAFSTRGLGTRMLMYCSLPSRCWRK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:APD  02322
  •   2  Database:DBAASP  5803
  •   3  Database:dbAMP  dbAMP_08465
  •   4  Database:SATPdb  satpdb16626

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A016626    From 1 To 36 E-value: 0.000000000000001 Score: 73.6
        MLWSASMRIFASAFSTRGLGTRMLMYCSLPSRCWRK
  • 2. L12A08806|    From 21 To 45 E-value: 4.4 Score: 21.9
        ASPRITSKSLCTPGCKTGILMTCPL
  • 3. L12A08808|    From 21 To 45 E-value: 6 Score: 21.6
        ASPRITSKSLCTAGCKTGILMTCPL
  • 4. L12A08807|    From 21 To 45 E-value: 6.4 Score: 21.2
        ASPRVTSKSLCTPGCKTGILMTCPL
  • 5. L12A09418|    From 20 To 46 E-value: 6.9 Score: 21.2
        ASTRITSISLCTPGCKTGVLMGCNLKT
  • 6. L13A016626    From 1 To 36 E-value: 0.000000000000001 Score: 73.6
        MLWSASMRIFASAFSTRGLGTRMLMYCSLPSRCWRK
  • 7. L12A08806|    From 21 To 45 E-value: 4.4 Score: 21.9
        ASPRITSKSLCTPGCKTGILMTCPL
  • 8. L12A08808|    From 21 To 45 E-value: 6 Score: 21.6
        ASPRITSKSLCTAGCKTGILMTCPL
  • 9. L12A08807|    From 21 To 45 E-value: 6.4 Score: 21.2
        ASPRVTSKSLCTPGCKTGILMTCPL
  • 10. L12A09418|    From 20 To 46 E-value: 6.9 Score: 21.2
        ASTRITSISLCTPGCKTGVLMGCNLKT

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: