Record in detail


General Info

  • lamp_id:L13A017688
  • Name:
  • FullName:
  • Source:
  • Mass:4724.4 Da
  • Sequence Length:45 aa
  • Isoelectric Point:7.76
  • Activity:antimicrobial
  • Sequence
        QLKNLACVTNEGPKWANTYCAAVCHMSGRGAGSCNAKDECVCSMT
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07809|    From 23 To 67 E-value: 9e-23 Score: 97.1
        QLKNLACVTNEGPKWANTYCAAVCHMSGRGAGSCNAKDECVCSMT
  • 2. L13A017688    From 1 To 45 E-value: 5e-22 Score: 94.7
        QLKNLACVTNEGPKWANTYCAAVCHMSGRGAGSCNAKDECVCSMT
  • 3. L05ADEF260    From 1 To 41 E-value: 1e-19 Score: 86.7
        LACVTNEGPKWANTYCAAVCHMSGRGAGSCNAKDECVCSMT
  • 4. L05ADEF555    From 1 To 38 E-value: 0.001 Score: 33.5
        VTCDLLSGIGWNHTFCAAHCIFKGYKGGACNSKGVCVC
  • 5. L03A000163    From 45 To 83 E-value: 0.003 Score: 32.3
        DILSVEAKGVKLNDAACAAHCLFRGRSGGYCNGKRVCVC
  • 6. L12A07809|    From 23 To 67 E-value: 9e-23 Score: 97.1
        QLKNLACVTNEGPKWANTYCAAVCHMSGRGAGSCNAKDECVCSMT
  • 7. L13A017688    From 1 To 45 E-value: 5e-22 Score: 94.7
        QLKNLACVTNEGPKWANTYCAAVCHMSGRGAGSCNAKDECVCSMT
  • 8. L05ADEF260    From 1 To 41 E-value: 1e-19 Score: 86.7
        LACVTNEGPKWANTYCAAVCHMSGRGAGSCNAKDECVCSMT
  • 9. L05ADEF555    From 1 To 38 E-value: 0.001 Score: 33.5
        VTCDLLSGIGWNHTFCAAHCIFKGYKGGACNSKGVCVC
  • 10. L03A000163    From 45 To 83 E-value: 0.003 Score: 32.3
        DILSVEAKGVKLNDAACAAHCLFRGRSGGYCNGKRVCVC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: