Record in detail


General Info

  • lamp_id:L13A018798
  • Name:
  • FullName:
  • Source:
  • Mass: Da
  • Sequence Length:30 aa
  • Isoelectric Point:
  • Activity:antibacterial,antimicrobial,anti-gram+,anti-gram-.
  • Sequence
        GWFKKTFHKVSHAVKSGIHAGQRGCSALGF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001573    From 1 To 30 E-value: 0.000000000003 Score: 62.4
        GWFKKTFHKVSHAVKSGIHAGQRGCSALGF
  • 2. L11A007994    From 1 To 30 E-value: 0.00000000003 Score: 58.9
        GXFKKTFHKVSHAVKSGIHAGQRGCSALGF
  • 3. L02A001574    From 2 To 30 E-value: 0.00002 Score: 39.3
        WFSRTVHNVGNAVRKGIHAGQGVCSGLGL
  • 4. L13A024666    From 2 To 29 E-value: 0.00004 Score: 38.9
        WFSRTVHNVGNAVRKGIHAGQGVCSGLG
  • 5. L11A007998    From 3 To 30 E-value: 0.0003 Score: 35.8
        FSRTVHNVGNAVRKGIHAGQGVCSGLGL
  • 6. L02A001573    From 1 To 30 E-value: 0.000000000003 Score: 62.4
        GWFKKTFHKVSHAVKSGIHAGQRGCSALGF
  • 7. L11A007994    From 1 To 30 E-value: 0.00000000003 Score: 58.9
        GXFKKTFHKVSHAVKSGIHAGQRGCSALGF
  • 8. L02A001574    From 2 To 30 E-value: 0.00002 Score: 39.3
        WFSRTVHNVGNAVRKGIHAGQGVCSGLGL
  • 9. L13A024666    From 2 To 29 E-value: 0.00004 Score: 38.9
        WFSRTVHNVGNAVRKGIHAGQGVCSGLG
  • 10. L11A007998    From 3 To 30 E-value: 0.0003 Score: 35.8
        FSRTVHNVGNAVRKGIHAGQGVCSGLGL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: