Record in detail


General Info

  • lamp_id:L13A019481
  • Name:
  • FullName:
  • Source:
  • Mass:3410 Da
  • Sequence Length:30 aa
  • Isoelectric Point:10.75
  • Activity:antibacterial,antimicrobial,anti-gram+.
  • Sequence
        MKTILRFVAGYDIASHKKKTGGYPWERGKA
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A019481    From 1 To 30 E-value: 0.0000000000007 Score: 64.3
        MKTILRFVAGYDIASHKKKTGGYPWERGKA
  • 2. L11A010757    From 10 To 33 E-value: 0.095 Score: 27.3
        TIVKKLTQYEIAWFKNKHGYYPWE
  • 3. L01A002787    From 8 To 31 E-value: 0.27 Score: 25.8
        IAKWMTGAELQAYKKKYGCLPWEK
  • 4. L01A002788    From 22 To 44 E-value: 0.27 Score: 25.8
        LTTYEINWYKQQYGRYPWERPVA
  • 5. L13A019481    From 1 To 30 E-value: 0.0000000000007 Score: 64.3
        MKTILRFVAGYDIASHKKKTGGYPWERGKA
  • 6. L11A010757    From 10 To 33 E-value: 0.095 Score: 27.3
        TIVKKLTQYEIAWFKNKHGYYPWE
  • 7. L01A002787    From 8 To 31 E-value: 0.27 Score: 25.8
        IAKWMTGAELQAYKKKYGCLPWEK
  • 8. L01A002788    From 22 To 44 E-value: 0.27 Score: 25.8
        LTTYEINWYKQQYGRYPWERPVA

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: