Record in detail
General Info
- lamp_id:L13A019481
- Name:
- FullName:
- Source:
- Mass:3410 Da
- Sequence Length:30 aa
- Isoelectric Point:10.75
- Activity:antibacterial,antimicrobial,anti-gram+.
- Sequence
MKTILRFVAGYDIASHKKKTGGYPWERGKA - Function:
Cross-Linking
- Cross-linking
- 1 Database:APD 02250
- 2 Database:DBAASP 10758
- 3 Database:dbAMP dbAMP_08312
- 4 Database:DRAMP DRAMP18195
- 5 Database:SATPdb satpdb19481
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L13A019481 From 1 To 30 E-value: 0.0000000000007 Score: 64.3
MKTILRFVAGYDIASHKKKTGGYPWERGKA - 2. L11A010757 From 10 To 33 E-value: 0.095 Score: 27.3
TIVKKLTQYEIAWFKNKHGYYPWE - 3. L01A002787 From 8 To 31 E-value: 0.27 Score: 25.8
IAKWMTGAELQAYKKKYGCLPWEK - 4. L01A002788 From 22 To 44 E-value: 0.27 Score: 25.8
LTTYEINWYKQQYGRYPWERPVA - 5. L13A019481 From 1 To 30 E-value: 0.0000000000007 Score: 64.3
MKTILRFVAGYDIASHKKKTGGYPWERGKA - 6. L11A010757 From 10 To 33 E-value: 0.095 Score: 27.3
TIVKKLTQYEIAWFKNKHGYYPWE - 7. L01A002787 From 8 To 31 E-value: 0.27 Score: 25.8
IAKWMTGAELQAYKKKYGCLPWEK - 8. L01A002788 From 22 To 44 E-value: 0.27 Score: 25.8
LTTYEINWYKQQYGRYPWERPVA
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database