Record in detail


General Info

  • lamp_id:L13A019673
  • Name:
  • FullName:
  • Source:
  • Mass:5634.4 Da
  • Sequence Length:50 aa
  • Isoelectric Point:5.67
  • Activity:antibacterial,antimicrobial,anti-gram+,anti-gram-.
  • Sequence
        SPIEPKGEILHRFRRSFCDYNLCVVSCKDSGFIGGYCSELDLCSCTIGWQ
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A019673    From 1 To 50 E-value: 3e-25 Score: 105
        SPIEPKGEILHRFRRSFCDYNLCVVSCKDSGFIGGYCSELDLCSCTIGWQ
  • 2. L12A07870|    From 41 To 87 E-value: 0.002 Score: 33.1
        AAIQEPAE-LNRHKRLTCEIDRSLCLLHCRLKGYLRAYCSQQKVCRCV
  • 3. L01A000307    From 6 To 33 E-value: 0.027 Score: 29.3
        DRSLCLLHCRLKGYLRAYCSQQKVCRCV
  • 4. L13A016532    From 9 To 32 E-value: 0.044 Score: 28.5
        LCVVHCRVRGYPDGYCSRKGICTC
  • 5. L12A09191|    From 51 To 96 E-value: 0.082 Score: 27.7
        QVHSRQKRATCDLLSAFGVGHAACAAHCIGHGYRGGYCNSKAVCTC
  • 6. L13A019673    From 1 To 50 E-value: 3e-25 Score: 105
        SPIEPKGEILHRFRRSFCDYNLCVVSCKDSGFIGGYCSELDLCSCTIGWQ
  • 7. L12A07870|    From 41 To 87 E-value: 0.002 Score: 33.1
        AAIQEPAE-LNRHKRLTCEIDRSLCLLHCRLKGYLRAYCSQQKVCRCV
  • 8. L01A000307    From 6 To 33 E-value: 0.027 Score: 29.3
        DRSLCLLHCRLKGYLRAYCSQQKVCRCV
  • 9. L13A016532    From 9 To 32 E-value: 0.044 Score: 28.5
        LCVVHCRVRGYPDGYCSRKGICTC
  • 10. L12A09191|    From 51 To 96 E-value: 0.082 Score: 27.7
        QVHSRQKRATCDLLSAFGVGHAACAAHCIGHGYRGGYCNSKAVCTC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: