Record in detail


General Info

  • lamp_id:L13A020657
  • Name:
  • FullName:
  • Source:
  • Mass: Da
  • Sequence Length:32 aa
  • Isoelectric Point:
  • Activity:antibacterial,antimicrobial,anti-gram+,anti-gram-.
  • Sequence
        WNSNRRFRVGRPPVVGRPGCVCFRAPCPCSNY
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001660    From 1 To 32 E-value: 0.0000000000002 Score: 65.9
        WNSNRRFRVGRPPVVGRPGCVCFRAPCPCSNY
  • 2. L02A001757    From 24 To 40 E-value: 0.0008 Score: 34.3
        GRPGCVCIRSPCPCANY
  • 3. L02A000988    From 14 To 37 E-value: 0.47 Score: 25
        GRPNPIFRPRPCICVRQPCPCDTY
  • 4. L11A010792    From 9 To 37 E-value: 0.54 Score: 25
        RPPFPGRPLPGGPLVLPGCVCVRAPCYCS
  • 5. L11A010791    From 26 To 39 E-value: 1.4 Score: 23.5
        PTCVCVRSPCPCDQ
  • 6. L02A001660    From 1 To 32 E-value: 0.0000000000002 Score: 65.9
        WNSNRRFRVGRPPVVGRPGCVCFRAPCPCSNY
  • 7. L02A001757    From 24 To 40 E-value: 0.0008 Score: 34.3
        GRPGCVCIRSPCPCANY
  • 8. L02A000988    From 14 To 37 E-value: 0.47 Score: 25
        GRPNPIFRPRPCICVRQPCPCDTY
  • 9. L11A010792    From 9 To 37 E-value: 0.54 Score: 25
        RPPFPGRPLPGGPLVLPGCVCVRAPCYCS
  • 10. L11A010791    From 26 To 39 E-value: 1.4 Score: 23.5
        PTCVCVRSPCPCDQ

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: