Record in detail


General Info

  • lamp_id:L13A020743
  • Name:
  • FullName:
  • Source:
  • Mass:5785.8 Da
  • Sequence Length:50 aa
  • Isoelectric Point:9.53
  • Activity:antimicrobial
  • Sequence
        WNPFRKLYRKECNDVTSCDTVSGVKTCTKKNCCHRKFFGKTILKAPECTV
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:SATPdb  satpdb20743

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003865    From 36 To 85 E-value: 2e-26 Score: 109
        WNPFRKLYRKECNDVTSCDTVSGVKTCTKKNCCHRKFFGKTILKAPECTV
  • 2. L02A001599    From 1 To 50 E-value: 6e-25 Score: 104
        WNPFRKLYRKECNDVTSCDTVSGVKTCTKKNCCHRKFFGKTILKAPECTV
  • 3. L13A020743    From 1 To 50 E-value: 7e-25 Score: 104
        WNPFRKLYRKECNDVTSCDTVSGVKTCTKKNCCHRKFFGKTILKAPECTV
  • 4. L02A001572    From 1 To 40 E-value: 0.000007 Score: 41.2
        WNPFKKIANRNCYPKTTCETAGGKKTCKDFSCCQIVLFGK
  • 5. L13A013092    From 1 To 40 E-value: 0.000007 Score: 41.2
        WNPFKKIANRNCYPKTTCETAGGKKTCKDFSCCQIVLFGK
  • 6. L01A003865    From 36 To 85 E-value: 2e-26 Score: 109
        WNPFRKLYRKECNDVTSCDTVSGVKTCTKKNCCHRKFFGKTILKAPECTV
  • 7. L02A001599    From 1 To 50 E-value: 6e-25 Score: 104
        WNPFRKLYRKECNDVTSCDTVSGVKTCTKKNCCHRKFFGKTILKAPECTV
  • 8. L13A020743    From 1 To 50 E-value: 7e-25 Score: 104
        WNPFRKLYRKECNDVTSCDTVSGVKTCTKKNCCHRKFFGKTILKAPECTV
  • 9. L02A001572    From 1 To 40 E-value: 0.000007 Score: 41.2
        WNPFKKIANRNCYPKTTCETAGGKKTCKDFSCCQIVLFGK
  • 10. L13A013092    From 1 To 40 E-value: 0.000007 Score: 41.2
        WNPFKKIANRNCYPKTTCETAGGKKTCKDFSCCQIVLFGK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: