Record in detail


General Info

  • lamp_id:L13A020798
  • Name:
  • FullName:
  • Source:
  • Mass:4785.5 Da
  • Sequence Length:42 aa
  • Isoelectric Point:12.21
  • Activity:antiviral,antimicrobial
  • Sequence
        PPSHRTTPASRSLPPLRVFVVLSFSGVHLNKIRIRAREIYES
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:avpdb  AVP1148
  •   2  Database:SATPdb  satpdb20798

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A020798    From 1 To 42 E-value: 9e-19 Score: 84
        PPSHRTTPASRSLPPLRVFVVLSFSGVHLNKIRIRAREIYES
  • 2. L13A028331    From 1 To 42 E-value: 0.0000003 Score: 45.4
        PPDGCNRPQQSRKPPPRCLICLMVGLIHLNKIRIRAREIYES
  • 3. L13A013699    From 1 To 42 E-value: 0.000003 Score: 42
        PPDEGYPPMRMQVPPLGGRIILVRVLLHLNKIRIRAREIYES
  • 4. L13A013914    From 1 To 42 E-value: 0.000004 Score: 41.6
        PPGKQHTPTSFTHPPPADILLPLSAMIHLNKIRIRAREIYES
  • 5. L13A021386    From 1 To 42 E-value: 0.000007 Score: 40.8
        PPLRYSPPGQRVIPPPADERFLRFLVFHLNKIRIRAREIYES
  • 6. L13A020798    From 1 To 42 E-value: 9e-19 Score: 84
        PPSHRTTPASRSLPPLRVFVVLSFSGVHLNKIRIRAREIYES
  • 7. L13A028331    From 1 To 42 E-value: 0.0000003 Score: 45.4
        PPDGCNRPQQSRKPPPRCLICLMVGLIHLNKIRIRAREIYES
  • 8. L13A013699    From 1 To 42 E-value: 0.000003 Score: 42
        PPDEGYPPMRMQVPPLGGRIILVRVLLHLNKIRIRAREIYES
  • 9. L13A013914    From 1 To 42 E-value: 0.000004 Score: 41.6
        PPGKQHTPTSFTHPPPADILLPLSAMIHLNKIRIRAREIYES
  • 10. L13A021386    From 1 To 42 E-value: 0.000007 Score: 40.8
        PPLRYSPPGQRVIPPPADERFLRFLVFHLNKIRIRAREIYES

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: