Record in detail


General Info

  • lamp_id:L13A020920
  • Name:
  • FullName:
  • Source:
  • Mass:4109 Da
  • Sequence Length:35 aa
  • Isoelectric Point:11.65
  • Activity:antibacterial,antimicrobial,anti-gram+,anti-gram-.
  • Sequence
        PPPVIKFNRPFLMWIVERDTRSILFMGKIVNPKAP
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:APD  02517
  •   2  Database:DBAASP  8166
  •   3  Database:dbAMP  dbAMP_09972
  •   4  Database:SATPdb  satpdb20920

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A020920    From 1 To 35 E-value: 0.000000000000004 Score: 72
        PPPVIKFNRPFLMWIVERDTRSILFMGKIVNPKAP
  • 2. L13A021643    From 9 To 19 E-value: 6.3 Score: 21.2
        PPAVKFNKPFV
  • 3. L13A023886    From 9 To 19 E-value: 9.4 Score: 20.8
        PPEVKFNKPFV
  • 4. L13A025110    From 9 To 19 E-value: 9.4 Score: 20.8
        PPEVKFNKPFV
  • 5. L13A020920    From 1 To 35 E-value: 0.000000000000004 Score: 72
        PPPVIKFNRPFLMWIVERDTRSILFMGKIVNPKAP
  • 6. L13A021643    From 9 To 19 E-value: 6.3 Score: 21.2
        PPAVKFNKPFV
  • 7. L13A023886    From 9 To 19 E-value: 9.4 Score: 20.8
        PPEVKFNKPFV
  • 8. L13A025110    From 9 To 19 E-value: 9.4 Score: 20.8
        PPEVKFNKPFV

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: