Record in detail
General Info
- lamp_id:L13A021386
- Name:
- FullName:
- Source:
- Mass:5045.8 Da
- Sequence Length:42 aa
- Isoelectric Point:11.26
- Activity:antiviral,antimicrobial
- Sequence
PPLRYSPPGQRVIPPPADERFLRFLVFHLNKIRIRAREIYES - Function:
Cross-Linking
- Cross-linking
- 1 Database:avpdb AVP1144
- 2 Database:SATPdb satpdb21386
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L13A021386 From 1 To 42 E-value: 6e-19 Score: 84.3
PPLRYSPPGQRVIPPPADERFLRFLVFHLNKIRIRAREIYES - 2. L13A013914 From 1 To 42 E-value: 0.000004 Score: 42
PPGKQHTPTSFTHPPPADILLPLSAMIHLNKIRIRAREIYES - 3. L13A020798 From 1 To 42 E-value: 0.000007 Score: 40.8
PPSHRTTPASRSLPPLRVFVVLSFSGVHLNKIRIRAREIYES - 4. L13A013699 From 1 To 42 E-value: 0.00001 Score: 40
PPDEGYPPMRMQVPPLGGRIILVRVLLHLNKIRIRAREIYES - 5. L13A025338 From 1 To 42 E-value: 0.00002 Score: 40
PPGSLGWPPNTTEPPPYLRLRLIFLFIHLNKIRIRAREIYES - 6. L13A021386 From 1 To 42 E-value: 6e-19 Score: 84.3
PPLRYSPPGQRVIPPPADERFLRFLVFHLNKIRIRAREIYES - 7. L13A013914 From 1 To 42 E-value: 0.000004 Score: 42
PPGKQHTPTSFTHPPPADILLPLSAMIHLNKIRIRAREIYES - 8. L13A020798 From 1 To 42 E-value: 0.000007 Score: 40.8
PPSHRTTPASRSLPPLRVFVVLSFSGVHLNKIRIRAREIYES - 9. L13A013699 From 1 To 42 E-value: 0.00001 Score: 40
PPDEGYPPMRMQVPPLGGRIILVRVLLHLNKIRIRAREIYES - 10. L13A025338 From 1 To 42 E-value: 0.00002 Score: 40
PPGSLGWPPNTTEPPPYLRLRLIFLFIHLNKIRIRAREIYES
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database