Record in detail
General Info
- lamp_id:L13A022715
- Name:
- FullName:
- Source:
- Mass:3972.7 Da
- Sequence Length:31 aa
- Isoelectric Point:10.62
- Activity:antiviral,antimicrobial
- Sequence
WFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE - Function:
Cross-Linking
- Cross-linking
- 1 Database:avpdb AVP1595
- 2 Database:SATPdb satpdb22715
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L13A016332 From 18 To 48 E-value: 0.00000000000004 Score: 68.6
WFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE - 2. L13A023613 From 12 To 42 E-value: 0.00000000000004 Score: 68.6
WFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE - 3. L13A026730 From 6 To 36 E-value: 0.00000000000006 Score: 68.2
WFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE - 4. L13A022715 From 1 To 31 E-value: 0.00000000000008 Score: 67.4
WFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE - 5. L13A027039 From 18 To 39 E-value: 0.000000002 Score: 52.8
WFQRIPLGWFHCTYQKGKQHCR - 6. L13A016332 From 18 To 48 E-value: 0.00000000000004 Score: 68.6
WFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE - 7. L13A023613 From 12 To 42 E-value: 0.00000000000004 Score: 68.6
WFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE - 8. L13A026730 From 6 To 36 E-value: 0.00000000000006 Score: 68.2
WFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE - 9. L13A022715 From 1 To 31 E-value: 0.00000000000008 Score: 67.4
WFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE - 10. L13A027039 From 18 To 39 E-value: 0.000000002 Score: 52.8
WFQRIPLGWFHCTYQKGKQHCR
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database