Record in detail


General Info

  • lamp_id:L13A023156
  • Name:
  • FullName:
  • Source:
  • Mass: Da
  • Sequence Length:32 aa
  • Isoelectric Point:
  • Activity:anticancer,antimicrobial,NA.
  • Sequence
        GIPCAESCVWIPPCTITALMGCSCKNNVCYNN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A027188    From 1 To 32 E-value: 0.0000000000001 Score: 66.6
        GIPCAESCVWIPPCTITALMGCSCKNNVCYNN
  • 2. L12A06260|    From 45 To 75 E-value: 0.000000000001 Score: 63.5
        GIPCAESCVWIP-CTITALMGCSCKNNVCYNN
  • 3. L11A004283    From 1 To 31 E-value: 0.00000000002 Score: 59.7
        GIPCAESCVWIP-CTITALMGCSCKNNVCYNN
  • 4. L11A004284    From 1 To 31 E-value: 0.00000000009 Score: 57.4
        GIPCAESCVWIP-CTITALXGCSCKNNVCYNN
  • 5. L12A06268|    From 45 To 75 E-value: 0.0000000001 Score: 56.6
        GIPCAESCVYIP-CTITALFGCSCKDKVCYNN
  • 6. L13A027188    From 1 To 32 E-value: 0.0000000000001 Score: 66.6
        GIPCAESCVWIPPCTITALMGCSCKNNVCYNN
  • 7. L12A06260|    From 45 To 75 E-value: 0.000000000001 Score: 63.5
        GIPCAESCVWIP-CTITALMGCSCKNNVCYNN
  • 8. L11A004283    From 1 To 31 E-value: 0.00000000002 Score: 59.7
        GIPCAESCVWIP-CTITALMGCSCKNNVCYNN
  • 9. L11A004284    From 1 To 31 E-value: 0.00000000009 Score: 57.4
        GIPCAESCVWIP-CTITALXGCSCKNNVCYNN
  • 10. L12A06268|    From 45 To 75 E-value: 0.0000000001 Score: 56.6
        GIPCAESCVYIP-CTITALFGCSCKDKVCYNN

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: