Record in detail


General Info

  • lamp_id:L13A023175
  • Name:
  • FullName:
  • Source:
  • Mass:3807.6 Da
  • Sequence Length:35 aa
  • Isoelectric Point:10.79
  • Activity:antibacterial,antimicrobial
  • Sequence
        MTRILPCLFLVLLAAAPLLANPANPLNLKKHHGVF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A023175    From 1 To 35 E-value: 0.00000000000002 Score: 69.3
        MTRILPCLFLVLLAAAPLLANPANPLNLKKHHGVF
  • 2. L11A004295    From 1 To 16 E-value: 0.0002 Score: 36.6
        GNPANPLNLKKHHGVF
  • 3. L13A013541    From 1 To 15 E-value: 0.0002 Score: 36.2
        NPANPLNLKKHHGVF
  • 4. L02A001316    From 1 To 15 E-value: 0.0002 Score: 36.2
        NPANPLNLKKHHGVF
  • 5. L12A09772|    From 1 To 15 E-value: 0.0003 Score: 35.8
        NPANPLNLKKHHGVF
  • 6. L13A023175    From 1 To 35 E-value: 0.00000000000002 Score: 69.3
        MTRILPCLFLVLLAAAPLLANPANPLNLKKHHGVF
  • 7. L11A004295    From 1 To 16 E-value: 0.0002 Score: 36.6
        GNPANPLNLKKHHGVF
  • 8. L13A013541    From 1 To 15 E-value: 0.0002 Score: 36.2
        NPANPLNLKKHHGVF
  • 9. L02A001316    From 1 To 15 E-value: 0.0002 Score: 36.2
        NPANPLNLKKHHGVF
  • 10. L12A09772|    From 1 To 15 E-value: 0.0003 Score: 35.8
        NPANPLNLKKHHGVF

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: