Record in detail


General Info

  • lamp_id:L13A023384
  • Name:
  • FullName:
  • Source:
  • Mass:4522.2 Da
  • Sequence Length:40 aa
  • Isoelectric Point:9.06
  • Activity:antibacterial,antimicrobial,antifungal
  • Sequence
        YSRCQLQGFNCVVRSYGLPTIPCCRGSYFPGSTYGRCQRP
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A023384    From 1 To 40 E-value: 3e-18 Score: 82
        YSRCQLQGFNCVVRSYGLPTIPCCRGSYFPGSTYGRCQRP
  • 2. L03A000161    From 24 To 66 E-value: 2e-16 Score: 76.6
        YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQR
  • 3. L12A08087|    From 24 To 66 E-value: 2e-16 Score: 76.3
        YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQR
  • 4. L01A002992    From 1 To 43 E-value: 7e-16 Score: 74.3
        YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQR
  • 5. L01A002892    From 1 To 43 E-value: 7e-16 Score: 74.3
        YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQR
  • 6. L13A023384    From 1 To 40 E-value: 3e-18 Score: 82
        YSRCQLQGFNCVVRSYGLPTIPCCRGSYFPGSTYGRCQRP
  • 7. L03A000161    From 24 To 66 E-value: 2e-16 Score: 76.6
        YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQR
  • 8. L12A08087|    From 24 To 66 E-value: 2e-16 Score: 76.3
        YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQR
  • 9. L01A002992    From 1 To 43 E-value: 7e-16 Score: 74.3
        YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQR
  • 10. L01A002892    From 1 To 43 E-value: 7e-16 Score: 74.3
        YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: