Record in detail


General Info

  • lamp_id:L13A023575
  • Name:
  • FullName:
  • Source:
  • Mass:5190.8 Da
  • Sequence Length:50 aa
  • Isoelectric Point:4.02
  • Activity:antimicrobial
  • Sequence
        MNLNGLPASTNVIDLRGKDMGTYIDANGACWAPDTPSIIMYPGGSGPSYS
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:SATPdb  satpdb23575

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09008|    From 16 To 65 E-value: 4e-25 Score: 105
        MNLNGLPASTNVIDLRGKDMGTYIDANGACWAPDTPSIIMYPGGSGPSYS
  • 2. L01A002809    From 1 To 50 E-value: 6e-25 Score: 104
        MNLNGLPASTNVIDLRGKDMGTYIDANGACWAPDTPSIIMYPGGSGPSYS
  • 3. L13A023575    From 1 To 50 E-value: 2e-24 Score: 102
        MNLNGLPASTNVIDLRGKDMGTYIDANGACWAPDTPSIIMYPGGSGPSYS
  • 4. L12A09008|    From 16 To 65 E-value: 4e-25 Score: 105
        MNLNGLPASTNVIDLRGKDMGTYIDANGACWAPDTPSIIMYPGGSGPSYS
  • 5. L01A002809    From 1 To 50 E-value: 6e-25 Score: 104
        MNLNGLPASTNVIDLRGKDMGTYIDANGACWAPDTPSIIMYPGGSGPSYS
  • 6. L13A023575    From 1 To 50 E-value: 2e-24 Score: 102
        MNLNGLPASTNVIDLRGKDMGTYIDANGACWAPDTPSIIMYPGGSGPSYS

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: