Record in detail


General Info

  • lamp_id:L13A023613
  • Name:
  • FullName:
  • Source:
  • Mass:5023.8 Da
  • Sequence Length:42 aa
  • Isoelectric Point:11.06
  • Activity:antiviral,antimicrobial
  • Sequence
        SPTGPPGSIRTWFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:avpdb  AVP1594
  •   2  Database:SATPdb  satpdb23613

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A016332    From 7 To 48 E-value: 8e-21 Score: 90.5
        SPTGPPGSIRTWFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE
  • 2. L13A023613    From 1 To 42 E-value: 1e-20 Score: 90.1
        SPTGPPGSIRTWFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE
  • 3. L13A026730    From 1 To 36 E-value: 6e-17 Score: 77.8
        GSIRTWFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE
  • 4. L13A027039    From 7 To 39 E-value: 7e-16 Score: 74.3
        SPTGPPGSIRTWFQRIPLGWFHCTYQKGKQHCR
  • 5. L13A022715    From 1 To 31 E-value: 0.00000000000004 Score: 68.6
        WFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE
  • 6. L13A016332    From 7 To 48 E-value: 8e-21 Score: 90.5
        SPTGPPGSIRTWFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE
  • 7. L13A023613    From 1 To 42 E-value: 1e-20 Score: 90.1
        SPTGPPGSIRTWFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE
  • 8. L13A026730    From 1 To 36 E-value: 6e-17 Score: 77.8
        GSIRTWFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE
  • 9. L13A027039    From 7 To 39 E-value: 7e-16 Score: 74.3
        SPTGPPGSIRTWFQRIPLGWFHCTYQKGKQHCR
  • 10. L13A022715    From 1 To 31 E-value: 0.00000000000004 Score: 68.6
        WFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: