Record in detail


General Info

  • lamp_id:L13A023723
  • Name:
  • FullName:
  • Source:
  • Mass:4988.8 Da
  • Sequence Length:44 aa
  • Isoelectric Point:11.85
  • Activity:antibacterial,antimicrobial,anti-gram+,anti-gram-.
  • Sequence
        RRRRRRPPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:APD  02373
  •   2  Database:DBAASP  5357
  •   3  Database:dbAMP  dbAMP_10722
  •   4  Database:SATPdb  satpdb23723

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003540    From 3 To 46 E-value: 1e-19 Score: 87
        RRRRRRPPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH
  • 2. L13A023723    From 1 To 44 E-value: 2e-19 Score: 86.7
        RRRRRRPPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH
  • 3. L11A005358    From 1 To 40 E-value: 6e-18 Score: 81.3
        RRPPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH
  • 4. L12A03233|    From 4 To 35 E-value: 0.71 Score: 24.6
        CWFLKGHCKQNCKPSEQVKKPCKNGDYCCMPS
  • 5. L05ADEF164    From 26 To 58 E-value: 1.6 Score: 23.1
        RRFLCKKMNGQCEAECFTFEQKIGTCQANFLCC
  • 6. L01A003540    From 3 To 46 E-value: 1e-19 Score: 87
        RRRRRRPPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH
  • 7. L13A023723    From 1 To 44 E-value: 2e-19 Score: 86.7
        RRRRRRPPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH
  • 8. L11A005358    From 1 To 40 E-value: 6e-18 Score: 81.3
        RRPPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH
  • 9. L12A03233|    From 4 To 35 E-value: 0.71 Score: 24.6
        CWFLKGHCKQNCKPSEQVKKPCKNGDYCCMPS
  • 10. L05ADEF164    From 26 To 58 E-value: 1.6 Score: 23.1
        RRFLCKKMNGQCEAECFTFEQKIGTCQANFLCC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: