Record in detail
General Info
- lamp_id:L13A023723
- Name:
- FullName:
- Source:
- Mass:4988.8 Da
- Sequence Length:44 aa
- Isoelectric Point:11.85
- Activity:antibacterial,antimicrobial,anti-gram+,anti-gram-.
- Sequence
RRRRRRPPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH - Function:
Cross-Linking
- Cross-linking
- 1 Database:APD 02373
- 2 Database:DBAASP 5357
- 3 Database:dbAMP dbAMP_10722
- 4 Database:SATPdb satpdb23723
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A003540 From 3 To 46 E-value: 1e-19 Score: 87
RRRRRRPPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH - 2. L13A023723 From 1 To 44 E-value: 2e-19 Score: 86.7
RRRRRRPPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH - 3. L11A005358 From 1 To 40 E-value: 6e-18 Score: 81.3
RRPPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH - 4. L12A03233| From 4 To 35 E-value: 0.71 Score: 24.6
CWFLKGHCKQNCKPSEQVKKPCKNGDYCCMPS - 5. L05ADEF164 From 26 To 58 E-value: 1.6 Score: 23.1
RRFLCKKMNGQCEAECFTFEQKIGTCQANFLCC - 6. L01A003540 From 3 To 46 E-value: 1e-19 Score: 87
RRRRRRPPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH - 7. L13A023723 From 1 To 44 E-value: 2e-19 Score: 86.7
RRRRRRPPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH - 8. L11A005358 From 1 To 40 E-value: 6e-18 Score: 81.3
RRPPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH - 9. L12A03233| From 4 To 35 E-value: 0.71 Score: 24.6
CWFLKGHCKQNCKPSEQVKKPCKNGDYCCMPS - 10. L05ADEF164 From 26 To 58 E-value: 1.6 Score: 23.1
RRFLCKKMNGQCEAECFTFEQKIGTCQANFLCC
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database