Record in detail
General Info
- lamp_id:L13A023961
- Name:
- FullName:
- Source:
- Mass:3704.5 Da
- Sequence Length:34 aa
- Isoelectric Point:11.49
- Activity:antibacterial,antimicrobial
- Sequence
KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKA - Function:
Cross-Linking
- Cross-linking
- 1 Database:SATPdb satpdb23961
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000063 From 1 To 34 E-value: 0.0000000000003 Score: 65.5
KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKA - 2. L13A023961 From 1 To 34 E-value: 0.0000000000004 Score: 65.5
KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKA - 3. L03A000213 From 27 To 60 E-value: 0.0000000000007 Score: 64.3
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKA - 4. L13A022492 From 3 To 36 E-value: 0.000000000001 Score: 63.9
KWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKA - 5. L13A028862 From 1 To 34 E-value: 0.000000000001 Score: 63.2
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKA - 6. L01A000063 From 1 To 34 E-value: 0.0000000000003 Score: 65.5
KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKA - 7. L13A023961 From 1 To 34 E-value: 0.0000000000004 Score: 65.5
KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKA - 8. L03A000213 From 27 To 60 E-value: 0.0000000000007 Score: 64.3
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKA - 9. L13A022492 From 3 To 36 E-value: 0.000000000001 Score: 63.9
KWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKA - 10. L13A028862 From 1 To 34 E-value: 0.000000000001 Score: 63.2
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKA
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database