Record in detail


General Info

  • lamp_id:L13A024235
  • Name:
  • FullName:
  • Source:
  • Mass: Da
  • Sequence Length:31 aa
  • Isoelectric Point:
  • Activity:antiviral,antimicrobial,NA.
  • Sequence
        SISCGESCAMISFCFTEVIGCSCKNKVCYLN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00206    From 1 To 31 E-value: 0.000000000003 Score: 62.4
        SISCGESCAMISFCFTEVIGCSCKNKVCYLN
  • 2. L01A002720    From 1 To 28 E-value: 0.00000000005 Score: 58.2
        CGESCAMISFCFTEVIGCSCKNKVCYLN
  • 3. L11A001773    From 1 To 28 E-value: 0.0000000003 Score: 55.8
        CGESCAXISFCFTEVIGCSCKNKVCYLN
  • 4. L02A001082    From 1 To 31 E-value: 0.000002 Score: 42.7
        SISCGESCVYIPCTVTALVGCTCKDKVCYLN
  • 5. L02A001092    From 3 To 30 E-value: 0.000004 Score: 42
        PCGESCVYIP-CFTAVVGCTCKDKVCYLN
  • 6. L06AT00206    From 1 To 31 E-value: 0.000000000003 Score: 62.4
        SISCGESCAMISFCFTEVIGCSCKNKVCYLN
  • 7. L01A002720    From 1 To 28 E-value: 0.00000000005 Score: 58.2
        CGESCAMISFCFTEVIGCSCKNKVCYLN
  • 8. L11A001773    From 1 To 28 E-value: 0.0000000003 Score: 55.8
        CGESCAXISFCFTEVIGCSCKNKVCYLN
  • 9. L02A001082    From 1 To 31 E-value: 0.000002 Score: 42.7
        SISCGESCVYIPCTVTALVGCTCKDKVCYLN
  • 10. L02A001092    From 3 To 30 E-value: 0.000004 Score: 42
        PCGESCVYIP-CFTAVVGCTCKDKVCYLN

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: