Record in detail
General Info
- lamp_id:L13A024235
- Name:
- FullName:
- Source:
- Mass: Da
- Sequence Length:31 aa
- Isoelectric Point:
- Activity:antiviral,antimicrobial,NA.
- Sequence
SISCGESCAMISFCFTEVIGCSCKNKVCYLN - Function:
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ3000
- 2 Database:DBAASP 2537
- 3 Database:dbAMP dbAMP_11069
- 4 Database:DRAMP DRAMP00875
- 5 Database:SATPdb satpdb24235
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L06AT00206 From 1 To 31 E-value: 0.000000000003 Score: 62.4
SISCGESCAMISFCFTEVIGCSCKNKVCYLN - 2. L01A002720 From 1 To 28 E-value: 0.00000000005 Score: 58.2
CGESCAMISFCFTEVIGCSCKNKVCYLN - 3. L11A001773 From 1 To 28 E-value: 0.0000000003 Score: 55.8
CGESCAXISFCFTEVIGCSCKNKVCYLN - 4. L02A001082 From 1 To 31 E-value: 0.000002 Score: 42.7
SISCGESCVYIPCTVTALVGCTCKDKVCYLN - 5. L02A001092 From 3 To 30 E-value: 0.000004 Score: 42
PCGESCVYIP-CFTAVVGCTCKDKVCYLN - 6. L06AT00206 From 1 To 31 E-value: 0.000000000003 Score: 62.4
SISCGESCAMISFCFTEVIGCSCKNKVCYLN - 7. L01A002720 From 1 To 28 E-value: 0.00000000005 Score: 58.2
CGESCAMISFCFTEVIGCSCKNKVCYLN - 8. L11A001773 From 1 To 28 E-value: 0.0000000003 Score: 55.8
CGESCAXISFCFTEVIGCSCKNKVCYLN - 9. L02A001082 From 1 To 31 E-value: 0.000002 Score: 42.7
SISCGESCVYIPCTVTALVGCTCKDKVCYLN - 10. L02A001092 From 3 To 30 E-value: 0.000004 Score: 42
PCGESCVYIP-CFTAVVGCTCKDKVCYLN
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database