Record in detail


General Info

  • lamp_id:L13A024550
  • Name:
  • FullName:
  • Source:
  • Mass:3938.6 Da
  • Sequence Length:32 aa
  • Isoelectric Point:11
  • Activity:antibacterial,antimicrobial,antifungal
  • Sequence
        QAFQTFKPDWNKIRYDAMKMQTSLGQMKKRFN
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:SATPdb  satpdb24550

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001018    From 1 To 32 E-value: 0.00000000000003 Score: 68.9
        QAFQTFKPDWNKIRYDAMKMQTSLGQMKKRFN
  • 2. L13A024550    From 1 To 32 E-value: 0.00000000000003 Score: 68.6
        QAFQTFKPDWNKIRYDAMKMQTSLGQMKKRFN
  • 3. L02A001020    From 1 To 32 E-value: 0.000000003 Score: 52
        QAFKTFTPDWNKIRNDAKRMQDNLEQMKKRFN
  • 4. L02A001021    From 1 To 32 E-value: 0.000000009 Score: 50.8
        QAFKTFTPDWNKIRNDAKRMQDNLEQMKKKFN
  • 5. L02A001018    From 1 To 32 E-value: 0.00000000000003 Score: 68.9
        QAFQTFKPDWNKIRYDAMKMQTSLGQMKKRFN
  • 6. L13A024550    From 1 To 32 E-value: 0.00000000000003 Score: 68.6
        QAFQTFKPDWNKIRYDAMKMQTSLGQMKKRFN
  • 7. L02A001020    From 1 To 32 E-value: 0.000000003 Score: 52
        QAFKTFTPDWNKIRNDAKRMQDNLEQMKKRFN
  • 8. L02A001021    From 1 To 32 E-value: 0.000000009 Score: 50.8
        QAFKTFTPDWNKIRNDAKRMQDNLEQMKKKFN

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: