Record in detail
General Info
- lamp_id:L13A024692
- Name:
- FullName:
- Source:
- Mass:2855.5 Da
- Sequence Length:26 aa
- Isoelectric Point:11.1
- Activity:antiparasitic,antimicrobial,antiplasmodial.
- Sequence
kwklfkkiekvgqgigavlkvlttgl - Function:
Cross-Linking
- Cross-linking
- 1 Database:DBAASP 2577
- 2 Database:DRAMP DRAMP03920
- 3 Database:SATPdb satpdb24692
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L13A024692 From 1 To 26 E-value: 0.00000002 Score: 49.7
KWKLFKKIEKVGQGIGAVLKVLTTGL - 2. L13A018983 From 1 To 26 E-value: 0.00000002 Score: 49.7
KWKLFKKIEKVGQGIGAVLKVLTTGL - 3. L11A007646 From 1 To 26 E-value: 0.000004 Score: 42
KWKLWKKIEKWGQGIGAVLKWLTTWL - 4. L13A013753 From 1 To 37 E-value: 0.000005 Score: 41.6
KWKLFKKIEKVGQNIRDGIIKAGPGIGAVLKVLTTGL - 5. L01A001017 From 1 To 21 E-value: 0.0005 Score: 35
KWKLFKKI-----GIGAVLKVLTTGL
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database