Record in detail


General Info

  • lamp_id:L13A025019
  • Name:
  • FullName:
  • Source:
  • Mass:3682.3 Da
  • Sequence Length:30 aa
  • Isoelectric Point:9.19
  • Activity:antibacterial,antiviral,antimicrobial,antifungal
  • Sequence
        RCICTTRTCRFPYRRLGTCIFQNRVYTFCC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09265|    From 64 To 93 E-value: 0.0000000000004 Score: 65.1
        RCICTTRTCRFPYRRLGTCIFQNRVYTFCC
  • 2. L12A09266|    From 64 To 93 E-value: 0.0000000000004 Score: 65.1
        RCICTTRTCRFPYRRLGTCIFQNRVYTFCC
  • 3. L12A09267|    From 64 To 93 E-value: 0.0000000000008 Score: 64.3
        RCICTTRTCRFPYRRLGTCLFQNRVYTFCC
  • 4. L13A025019    From 1 To 30 E-value: 0.00000000001 Score: 60.1
        RCICTTRTCRFPYRRLGTCIFQNRVYTFCC
  • 5. L01A003255    From 2 To 31 E-value: 0.00000000001 Score: 60.1
        RCICTTRTCRFPYRRLGTCIFQNRVYTFCC
  • 6. L12A09265|    From 64 To 93 E-value: 0.0000000000004 Score: 65.1
        RCICTTRTCRFPYRRLGTCIFQNRVYTFCC
  • 7. L12A09266|    From 64 To 93 E-value: 0.0000000000004 Score: 65.1
        RCICTTRTCRFPYRRLGTCIFQNRVYTFCC
  • 8. L12A09267|    From 64 To 93 E-value: 0.0000000000008 Score: 64.3
        RCICTTRTCRFPYRRLGTCLFQNRVYTFCC
  • 9. L13A025019    From 1 To 30 E-value: 0.00000000001 Score: 60.1
        RCICTTRTCRFPYRRLGTCIFQNRVYTFCC
  • 10. L01A003255    From 2 To 31 E-value: 0.00000000001 Score: 60.1
        RCICTTRTCRFPYRRLGTCIFQNRVYTFCC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: