Record in detail


General Info

  • lamp_id:L13A025263
  • Name:
  • FullName:
  • Source:
  • Mass:4028.6 Da
  • Sequence Length:33 aa
  • Isoelectric Point:8.79
  • Activity:antiviral,antimicrobial
  • Sequence
        YKFACPECPKRFMRSDHLSKHITLHELLGEERR
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:avpdb  AVP1490
  •   2  Database:SATPdb  satpdb25263

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A025263    From 1 To 33 E-value: 0.000000000000007 Score: 70.9
        YKFACPECPKRFMRSDHLSKHITLHELLGEERR
  • 2. L12A12141|    From 2 To 33 E-value: 0.00000000000005 Score: 68.2
        KFACPECPKRFMRSDHLSKHITLHELLGEERR
  • 3. L13A016665    From 1 To 26 E-value: 0.000000002 Score: 52.8
        YKFACPECPKRFMRSDHLTLHILLHE
  • 4. L13A021905    From 2 To 26 E-value: 0.000000006 Score: 51.2
        KFACPECPKRFMRSDHLSKHIKTHQ
  • 5. L12A12142|    From 2 To 26 E-value: 0.00000001 Score: 50.1
        KFACPECPKRFMRSDHLTLHILLHE
  • 6. L13A025263    From 1 To 33 E-value: 0.000000000000007 Score: 70.9
        YKFACPECPKRFMRSDHLSKHITLHELLGEERR
  • 7. L12A12141|    From 2 To 33 E-value: 0.00000000000005 Score: 68.2
        KFACPECPKRFMRSDHLSKHITLHELLGEERR
  • 8. L13A016665    From 1 To 26 E-value: 0.000000002 Score: 52.8
        YKFACPECPKRFMRSDHLTLHILLHE
  • 9. L13A021905    From 2 To 26 E-value: 0.000000006 Score: 51.2
        KFACPECPKRFMRSDHLSKHIKTHQ
  • 10. L12A12142|    From 2 To 26 E-value: 0.00000001 Score: 50.1
        KFACPECPKRFMRSDHLTLHILLHE

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: