Record in detail


General Info

  • lamp_id:L13A025802
  • Name:
  • FullName:
  • Source:
  • Mass:4154.6 Da
  • Sequence Length:36 aa
  • Isoelectric Point:4.52
  • Activity:antiviral,antimicrobial
  • Sequence
        VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDSI
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A016394    From 8 To 43 E-value: 0.000000000000009 Score: 70.9
        VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDSI
  • 2. L12A01089|    From 8 To 43 E-value: 0.000000000000009 Score: 70.5
        VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDSI
  • 3. L13A025802    From 1 To 36 E-value: 0.00000000000001 Score: 70.5
        VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDSI
  • 4. L01A003936    From 1 To 35 E-value: 0.00000000000003 Score: 68.9
        VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDS
  • 5. L13A016492    From 1 To 35 E-value: 0.00000000000003 Score: 68.6
        VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDS
  • 6. L13A016394    From 8 To 43 E-value: 0.000000000000009 Score: 70.9
        VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDSI
  • 7. L12A01089|    From 8 To 43 E-value: 0.000000000000009 Score: 70.5
        VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDSI
  • 8. L13A025802    From 1 To 36 E-value: 0.00000000000001 Score: 70.5
        VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDSI
  • 9. L01A003936    From 1 To 35 E-value: 0.00000000000003 Score: 68.9
        VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDS
  • 10. L13A016492    From 1 To 35 E-value: 0.00000000000003 Score: 68.6
        VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDS

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: