Record in detail


General Info

  • lamp_id:L13A025874
  • Name:
  • FullName:
  • Source:
  • Mass:4616.2 Da
  • Sequence Length:40 aa
  • Isoelectric Point:6.81
  • Activity:antibacterial,antimicrobial,antifungal,anti-gram+,anti-gram-.
  • Sequence
        SDKPDVKEVESFDKSKLKKVETQEKNPLPTKETIEQEKKG
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A025874    From 1 To 40 E-value: 3e-16 Score: 75.5
        SDKPDVKEVESFDKSKLKKVETQEKNPLPTKETIEQEKKG
  • 2. L01A001275    From 2 To 18 E-value: 0.001 Score: 33.5
        FDKSKLKKTETQEKNPL
  • 3. L11A011841    From 23 To 33 E-value: 3.9 Score: 21.9
        EVASFDKSKLK
  • 4. L13A021327    From 1 To 11 E-value: 4.3 Score: 21.9
        EVASFDKSKLK
  • 5. L11A009402    From 1 To 11 E-value: 8.8 Score: 20.8
        EIEKFDKSKLK
  • 6. L13A025874    From 1 To 40 E-value: 3e-16 Score: 75.5
        SDKPDVKEVESFDKSKLKKVETQEKNPLPTKETIEQEKKG
  • 7. L01A001275    From 2 To 18 E-value: 0.001 Score: 33.5
        FDKSKLKKTETQEKNPL
  • 8. L11A011841    From 23 To 33 E-value: 3.9 Score: 21.9
        EVASFDKSKLK
  • 9. L13A021327    From 1 To 11 E-value: 4.3 Score: 21.9
        EVASFDKSKLK
  • 10. L11A009402    From 1 To 11 E-value: 8.8 Score: 20.8
        EIEKFDKSKLK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: