Record in detail


General Info

  • lamp_id:L13A025910
  • Name:
  • FullName:
  • Source:
  • Mass:4485.2 Da
  • Sequence Length:38 aa
  • Isoelectric Point:10.24
  • Activity:antiviral,antimicrobial
  • Sequence
        NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A00846|    From 4 To 41 E-value: 4e-16 Score: 75.5
        NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
  • 2. L13A025910    From 1 To 38 E-value: 4e-16 Score: 75.1
        NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
  • 3. L12A10045|    From 14 To 51 E-value: 0.000000000000002 Score: 72.8
        NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKQQ
  • 4. L12A09765|    From 1 To 38 E-value: 0.000000000000004 Score: 72
        NNLLRAIEAQQHLLQLTVWQIKQLQARILAVERYLKDQ
  • 5. L12A04662|    From 34 To 62 E-value: 0.00000000002 Score: 59.3
        NNLLRAIEAQQHLLQLTVWGIKQLQARIL
  • 6. L12A00846|    From 4 To 41 E-value: 4e-16 Score: 75.5
        NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
  • 7. L13A025910    From 1 To 38 E-value: 4e-16 Score: 75.1
        NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
  • 8. L12A10045|    From 14 To 51 E-value: 0.000000000000002 Score: 72.8
        NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKQQ
  • 9. L12A09765|    From 1 To 38 E-value: 0.000000000000004 Score: 72
        NNLLRAIEAQQHLLQLTVWQIKQLQARILAVERYLKDQ
  • 10. L12A04662|    From 34 To 62 E-value: 0.00000000002 Score: 59.3
        NNLLRAIEAQQHLLQLTVWGIKQLQARIL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: