Record in detail


General Info

  • lamp_id:L13A026485
  • Name:
  • FullName:
  • Source:
  • Mass: Da
  • Sequence Length:32 aa
  • Isoelectric Point:
  • Activity:antibacterial,antimicrobial,anti-gram+,anti-gram-.
  • Sequence
        DLRFLYPRGKLPVPTPPPFNPKPIYIDMGNRY
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000222    From 1 To 32 E-value: 0.0000000000005 Score: 65.1
        DLRFLYPRGKLPVPTPPPFNPKPIYIDMGNRY
  • 2. L01A000596    From 1 To 32 E-value: 0.000000000003 Score: 62.4
        DLRFLYPRGKLPVPTLPPFNPKPIYIDMGNRY
  • 3. L01A000312    From 1 To 32 E-value: 0.0000000007 Score: 54.3
        DLRFWNPREKLPLPTLPPFNPKPIYIDMGNRY
  • 4. L01A000222    From 1 To 32 E-value: 0.0000000000005 Score: 65.1
        DLRFLYPRGKLPVPTPPPFNPKPIYIDMGNRY
  • 5. L01A000596    From 1 To 32 E-value: 0.000000000003 Score: 62.4
        DLRFLYPRGKLPVPTLPPFNPKPIYIDMGNRY
  • 6. L01A000312    From 1 To 32 E-value: 0.0000000007 Score: 54.3
        DLRFWNPREKLPLPTLPPFNPKPIYIDMGNRY

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: