Record in detail


General Info

  • lamp_id:L13A026722
  • Name:
  • FullName:
  • Source:
  • Mass:4226 Da
  • Sequence Length:35 aa
  • Isoelectric Point:9.91
  • Activity:anticancer,antibacterial,antimicrobial
  • Sequence
        YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:cancerppd  4461
  •   2  Database:SATPdb  satpdb26722

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A026722    From 1 To 35 E-value: 3e-16 Score: 75.5
        YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWK
  • 2. L02A001650    From 1 To 35 E-value: 3e-16 Score: 75.5
        YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWK
  • 3. L12A02180|    From 9 To 43 E-value: 4e-16 Score: 75.1
        YKQCHKKGGHCFPKEKICIPPSSDFGKMDCRWRWK
  • 4. L12A12207|    From 1 To 35 E-value: 5e-16 Score: 74.7
        YKQCHKKGGHCFPKEKICIPPSSDFGKMDCRWRWK
  • 5. L12A07925|    From 23 To 57 E-value: 0.000000000000003 Score: 72.4
        YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWRWK
  • 6. L13A026722    From 1 To 35 E-value: 3e-16 Score: 75.5
        YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWK
  • 7. L02A001650    From 1 To 35 E-value: 3e-16 Score: 75.5
        YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWK
  • 8. L12A02180|    From 9 To 43 E-value: 4e-16 Score: 75.1
        YKQCHKKGGHCFPKEKICIPPSSDFGKMDCRWRWK
  • 9. L12A12207|    From 1 To 35 E-value: 5e-16 Score: 74.7
        YKQCHKKGGHCFPKEKICIPPSSDFGKMDCRWRWK
  • 10. L12A07925|    From 23 To 57 E-value: 0.000000000000003 Score: 72.4
        YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWRWK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: