Record in detail
General Info
- lamp_id:L13A026982
- Name:
- FullName:
- Source:
- Mass:4157.5 Da
- Sequence Length:36 aa
- Isoelectric Point:4.33
- Activity:antiviral,antimicrobial
- Sequence
VANDPIDISIELNKAKSDLEESKEWIRRSNQKLDSD - Function:
Cross-Linking
- Cross-linking
- 1 Database:avpdb AVP1564
- 2 Database:dbAMP dbAMP_11657
- 3 Database:SATPdb satpdb26982
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L13A026982 From 1 To 36 E-value: 0.000000000000008 Score: 70.9
VANDPIDISIELNKAKSDLEESKEWIRRSNQKLDSD - 2. L13A027781 From 1 To 35 E-value: 0.00000000000003 Score: 68.9
VANDPIDISIELNKAKSDLEESKEWIRRSNQKLDS - 3. L13A016492 From 1 To 36 E-value: 0.00000000000008 Score: 67.4
VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDSD - 4. L12A01089| From 8 To 42 E-value: 0.0000000000002 Score: 66.2
VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDS - 5. L01A003936 From 1 To 35 E-value: 0.0000000000003 Score: 65.9
VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDS - 6. L13A026982 From 1 To 36 E-value: 0.000000000000008 Score: 70.9
VANDPIDISIELNKAKSDLEESKEWIRRSNQKLDSD - 7. L13A027781 From 1 To 35 E-value: 0.00000000000003 Score: 68.9
VANDPIDISIELNKAKSDLEESKEWIRRSNQKLDS - 8. L13A016492 From 1 To 36 E-value: 0.00000000000008 Score: 67.4
VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDSD - 9. L12A01089| From 8 To 42 E-value: 0.0000000000002 Score: 66.2
VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDS - 10. L01A003936 From 1 To 35 E-value: 0.0000000000003 Score: 65.9
VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDS
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database