Record in detail


General Info

  • lamp_id:L13A027397
  • Name:
  • FullName:
  • Source:
  • Mass:3913.3 Da
  • Sequence Length:34 aa
  • Isoelectric Point:4.46
  • Activity:antiviral,antimicrobial
  • Sequence
        NNSVALDPIDISIELNKAKSDLEESKEWIRRSNQ
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:avpdb  AVP1263
  •   2  Database:SATPdb  satpdb27397

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A016394    From 5 To 38 E-value: 0.00000000000007 Score: 67.8
        NNSVALDPIDISIELNKAKSDLEESKEWIRRSNQ
  • 2. L01A003939    From 1 To 34 E-value: 0.00000000000008 Score: 67.4
        NNSVALDPIDISIELNKAKSDLEESKEWIRRSNQ
  • 3. L01A003940    From 2 To 35 E-value: 0.00000000000008 Score: 67.4
        NNSVALDPIDISIELNKAKSDLEESKEWIRRSNQ
  • 4. L13A027397    From 1 To 34 E-value: 0.00000000000009 Score: 67.4
        NNSVALDPIDISIELNKAKSDLEESKEWIRRSNQ
  • 5. L01A003938    From 1 To 33 E-value: 0.0000000000003 Score: 65.9
        NSVALDPIDISIELNKAKSDLEESKEWIRRSNQ
  • 6. L13A016394    From 5 To 38 E-value: 0.00000000000007 Score: 67.8
        NNSVALDPIDISIELNKAKSDLEESKEWIRRSNQ
  • 7. L01A003939    From 1 To 34 E-value: 0.00000000000008 Score: 67.4
        NNSVALDPIDISIELNKAKSDLEESKEWIRRSNQ
  • 8. L01A003940    From 2 To 35 E-value: 0.00000000000008 Score: 67.4
        NNSVALDPIDISIELNKAKSDLEESKEWIRRSNQ
  • 9. L13A027397    From 1 To 34 E-value: 0.00000000000009 Score: 67.4
        NNSVALDPIDISIELNKAKSDLEESKEWIRRSNQ
  • 10. L01A003938    From 1 To 33 E-value: 0.0000000000003 Score: 65.9
        NSVALDPIDISIELNKAKSDLEESKEWIRRSNQ

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: