Record in detail


General Info

  • lamp_id:L13A027605
  • Name:
  • FullName:
  • Source:
  • Mass:5727.4 Da
  • Sequence Length:50 aa
  • Isoelectric Point:10.07
  • Activity:antiparasitic,cell-cellcommunication,antimicrobial,antitrypanosomic.
  • Sequence
        YRQSMNQGSRSNGCRFGTCTFQKLAHQIYQLTDKDKDGMAPRNKISPQGY
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:parapep  1323
  •   2  Database:SATPdb  satpdb27605

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A027605    From 1 To 50 E-value: 7e-26 Score: 107
        YRQSMNQGSRSNGCRFGTCTFQKLAHQIYQLTDKDKDGMAPRNKISPQGY
  • 2. L12A12275|    From 1 To 52 E-value: 8e-20 Score: 87.4
        YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY
  • 3. L02A001479    From 1 To 52 E-value: 8e-20 Score: 87.4
        YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY
  • 4. L13A021812    From 1 To 50 E-value: 2e-18 Score: 83.2
        YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQ
  • 5. L03A000256    From 28 To 43 E-value: 7.4 Score: 21.2
        RGGFCRFGSCRFPHIA
  • 6. L13A027605    From 1 To 50 E-value: 7e-26 Score: 107
        YRQSMNQGSRSNGCRFGTCTFQKLAHQIYQLTDKDKDGMAPRNKISPQGY
  • 7. L12A12275|    From 1 To 52 E-value: 8e-20 Score: 87.4
        YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY
  • 8. L02A001479    From 1 To 52 E-value: 8e-20 Score: 87.4
        YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY
  • 9. L13A021812    From 1 To 50 E-value: 2e-18 Score: 83.2
        YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQ
  • 10. L03A000256    From 28 To 43 E-value: 7.4 Score: 21.2
        RGGFCRFGSCRFPHIA

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: