Record in detail
General Info
- lamp_id:L13A027838
- Name:
- FullName:
- Source:
- Mass:4178.9 Da
- Sequence Length:36 aa
- Isoelectric Point:13.35
- Activity:antiviral,cell-cellcommunication,antimicrobial
- Sequence
LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF - Function:
Cross-Linking
- Cross-linking
- 1 Database:DBAASP 5979
- 2 Database:dbAMP dbAMP_06083
- 3 Database:HIPdb HIP824
- 4 Database:SATPdb satpdb27838
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L13A027838 From 1 To 36 E-value: 0.00000000000001 Score: 70.1
LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF - 2. L13A024642 From 1 To 17 E-value: 0.0002 Score: 36.6
KFRRQRPRLSHKGPMPF - 3. L13A018646 From 1 To 13 E-value: 0.018 Score: 29.6
QRPRLSHKGPMPF - 4. L13A019770 From 1 To 12 E-value: 0.073 Score: 27.7
RPRLSHKGPMPF - 5. L13A014229 From 1 To 11 E-value: 0.21 Score: 26.2
PRLSHKGPMPF - 6. L13A027838 From 1 To 36 E-value: 0.00000000000001 Score: 70.1
LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF - 7. L13A024642 From 1 To 17 E-value: 0.0002 Score: 36.6
KFRRQRPRLSHKGPMPF - 8. L13A018646 From 1 To 13 E-value: 0.018 Score: 29.6
QRPRLSHKGPMPF - 9. L13A019770 From 1 To 12 E-value: 0.073 Score: 27.7
RPRLSHKGPMPF - 10. L13A014229 From 1 To 11 E-value: 0.21 Score: 26.2
PRLSHKGPMPF
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database