Record in detail


General Info

  • lamp_id:L13A028221
  • Name:
  • FullName:
  • Source:
  • Mass:3330.9 Da
  • Sequence Length:30 aa
  • Isoelectric Point:11
  • Activity:antibacterial,antimicrobial,antifungal
  • Sequence
        WLSKTYKKLENSAKKRISEGVAIAILGGLR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06926|    From 15 To 44 E-value: 0.000000000003 Score: 62
        WLSKTYKKLENSAKKRISEGVAIAILGGLR
  • 2. L02A001527    From 2 To 31 E-value: 0.00000000002 Score: 59.7
        WLSKTYKKLENSAKKRISEGVAIAILGGLR
  • 3. L13A028221    From 1 To 30 E-value: 0.00000000002 Score: 59.7
        WLSKTYKKLENSAKKRISEGVAIAILGGLR
  • 4. L12A06909|    From 25 To 54 E-value: 0.0000000001 Score: 56.6
        WLSKTYKKLENSAKKRISEGIAIAIQGGPR
  • 5. L12A07534|    From 15 To 44 E-value: 0.0000000002 Score: 56.6
        WLSKTYKKLENSAKKRISEGIAIAIQGGPR
  • 6. L12A06926|    From 15 To 44 E-value: 0.000000000003 Score: 62
        WLSKTYKKLENSAKKRISEGVAIAILGGLR
  • 7. L02A001527    From 2 To 31 E-value: 0.00000000002 Score: 59.7
        WLSKTYKKLENSAKKRISEGVAIAILGGLR
  • 8. L13A028221    From 1 To 30 E-value: 0.00000000002 Score: 59.7
        WLSKTYKKLENSAKKRISEGVAIAILGGLR
  • 9. L12A06909|    From 25 To 54 E-value: 0.0000000001 Score: 56.6
        WLSKTYKKLENSAKKRISEGIAIAIQGGPR
  • 10. L12A07534|    From 15 To 44 E-value: 0.0000000002 Score: 56.6
        WLSKTYKKLENSAKKRISEGIAIAIQGGPR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: