Record in detail


General Info

  • lamp_id:L13A028403
  • Name:
  • FullName:
  • Source:
  • Mass:3870.4 Da
  • Sequence Length:31 aa
  • Isoelectric Point:4.3
  • Activity:antiviral,antimicrobial
  • Sequence
        NEVAKNLNESLIDLQELGKYEQYIKWPWYVW
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:avpdb  AVP0550
  •   2  Database:SATPdb  satpdb28403

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A021240    From 7 To 37 E-value: 0.0000000000006 Score: 64.7
        NEVAKNLNESLIDLQELGKYEQYIKWPWYVW
  • 2. L13A028403    From 1 To 31 E-value: 0.0000000000007 Score: 64.3
        NEVAKNLNESLIDLQELGKYEQYIKWPWYVW
  • 3. L13A016473    From 19 To 46 E-value: 0.00000000002 Score: 59.3
        NEVAKNLNESLIDLQELGKYEQYIKWPW
  • 4. L13A027929    From 16 To 43 E-value: 0.00000000002 Score: 59.3
        NEVAKNLNESLIDLQELGKYEQYIKWPW
  • 5. L13A022444    From 12 To 39 E-value: 0.00000000003 Score: 58.9
        NEVAKNLNESLIDLQELGKYEQYIKWPW
  • 6. L13A021240    From 7 To 37 E-value: 0.0000000000006 Score: 64.7
        NEVAKNLNESLIDLQELGKYEQYIKWPWYVW
  • 7. L13A028403    From 1 To 31 E-value: 0.0000000000007 Score: 64.3
        NEVAKNLNESLIDLQELGKYEQYIKWPWYVW
  • 8. L13A016473    From 19 To 46 E-value: 0.00000000002 Score: 59.3
        NEVAKNLNESLIDLQELGKYEQYIKWPW
  • 9. L13A027929    From 16 To 43 E-value: 0.00000000002 Score: 59.3
        NEVAKNLNESLIDLQELGKYEQYIKWPW
  • 10. L13A022444    From 12 To 39 E-value: 0.00000000003 Score: 58.9
        NEVAKNLNESLIDLQELGKYEQYIKWPW

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: