Record in detail
- Enzy_Id:EN2352778
Name:LYSC_PAVCR
FullName:Lysozyme C
Producer Organism:Pavo cristatus
Sequence Length:129
Mass:14422
Isoelectric Point:9.43
Target:Gram-positive bacteria
Link:P19849 - Function:Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.
- Antibacterial Activities
No MICs found on enzybiotics database
- Sequence
- KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKFESNFNTHATNRNTDGSTDYGILQINS RWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDRNGMNAWVAWRNRCKGTDV HAWIRGCRL
- Domains
- 1 Name:Glyco_hydro_22 Interpro Link:IPR001916
- 2 Name:Glyco_hydro_22_CS Interpro Link:IPR019799
- 3 Name:Glyco_hydro_22_lys Interpro Link:IPR000974
- 4 Name:Lysozyme-like_dom Interpro Link:IPR023346
- Structures
No structs found on enzybiotics database
- Reference
- [1] Torikata T.,Kuramoto M.,Kudo K.,Araki T.,
- Title:The amino acid sequence of Indian peafowl (Pavo cristatus) lysozyme and its comparison with lysozymes from phasianoid birds.
- Journal:Agric. Biol. Chem.,1989,(53):2955-2962 [:]