Record in detail
- Enzy_Id:EN30296312
Name:LYSC_PAPAN
FullName:Lysozyme C
Producer Organism:Papio anubis
Sequence Length:148
Mass:16409
Isoelectric Point:8.2
Target:Gram-positive bacteria
Link:P61629 - Function:Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.
- Antibacterial Activities
No MICs found on enzybiotics database
- Sequence
- MKAVIILGLVLLSVTVQGKIFERCELARTLKRLGLDGYRGISLANWVCLAKWESDYNTQA TNYNPGDQSTDYGIFQINSHYWCNNGKTPGAVNACHISCNALLQDNIADAVTCAKRVVSD PQGIRAWVAWRNHCQNRDVSQYVQGCGV
- Domains
- 1 Name:Glyco_hydro_22 Interpro Link:IPR001916
- 2 Name:Glyco_hydro_22_CS Interpro Link:IPR019799
- 3 Name:Glyco_hydro_22_lys Interpro Link:IPR000974
- 4 Name:Lysozyme-like_dom Interpro Link:IPR023346
- Structures
No structs found on enzybiotics database
- Reference
- [1] Stewart C.B.,Messier W.,
- Title:Episodic adaptive evolution of primate lysozymes.
- Journal:Nature,1997,(385):151-154 [MEDLINE:97144349]
- [2] Jolles P.,Buss D.H.,Jolles J.,Hermann J.,
- Title:Amino acid sequence of lysozyme from baboon milk.
- Journal:J. Mol. Biol.,1973,(79):587-595 [MEDLINE:74043811]