Record in detail
- Enzy_Id:EN33719230
Name:LYSC_AMYCA
FullName:Lysozyme C
Producer Organism:Amyda cartilaginea
Sequence Length:130
Mass:14543
Isoelectric Point:8.19
Target:Gram-positive bacteria
Link:P85345 - Function:Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Has strong bacteriolytic activity against M.luteus and V.cholerae, weak bacteriolytic activity against P.aeruginosa and no activity against A.hydrophila.
- Antibacterial Activities
No MICs found on enzybiotics database
- Sequence
- KIYEQCEAAREMKRLGLDGYDGYSLGDWVCTAKHESNFNTGATNYNRGDQSTDYGIFQIN SRWWCNDGKTPNAKNACGIECSELLKADITAAVICAKRVVRDPNGMGAWVAWTKYCKGKD VSQWIKGCKL
- Domains
- 1 Name:Glyco_hydro_22 Interpro Link:IPR001916
- 2 Name:Glyco_hydro_22_CS Interpro Link:IPR019799
- 3 Name:Glyco_hydro_22_lys Interpro Link:IPR000974
- 4 Name:Lysozyme-like_dom Interpro Link:IPR023346
- Structures
No structs found on enzybiotics database
- Reference
- [1] Phonyothee P.,Khanchanuan R.,Preecharram S.,Ponkham P.,Thammasirirak S.,
- Title:Purification, characterization and comparison of reptile lysozymes.
- Journal:Comp. Biochem. Physiol.,2006,(143):209-217 [PubMed:16549391]