Record in detail
- Enzy_Id:EN36243309
Name:LYSC_CALCC
FullName:Lysozyme C
Producer Organism:Callipepla californica
Sequence Length:129
Mass:14308
Isoelectric Point:9.21
Target:Gram-positive bacteria
Link:P00699 - Function:Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.
- Antibacterial Activities
No MICs found on enzybiotics database
- Sequence
- KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNSQATNRNTDGSTDYGVLQINS RWWCNDGRTPGSRNLCNIPCSALLSSDITATVNCAKKIVSDGNGMNAWVAWRNRCKGTDV HAWIRGCRL
- Domains
- 1 Name:Glyco_hydro_22 Interpro Link:IPR001916
- 2 Name:Glyco_hydro_22_CS Interpro Link:IPR019799
- 3 Name:Glyco_hydro_22_lys Interpro Link:IPR000974
- 4 Name:Lysozyme-like_dom Interpro Link:IPR023346
- Structures
No structs found on enzybiotics database
- Reference
- [1] Wilson A.C.,White T.J.,Prager E.M.,Ibrahimi I.M.,
- Title:Amino acid sequence of California quail lysozyme. Effect of evolutionary substitutions on the antigenic structure of lysozyme.
- Journal:Biochemistry,1979,(18):2736-2744 [MEDLINE:80000412]