Record in detail
- Enzy_Id:EN36484538
Name:ENVC_ECOLI
FullName:Murein hydrolase activator EnvC,YibP,EnvC
Producer Organism:Escherichia coli (strain K12)
Sequence Length:419
Mass:46595
Isoelectric Point:10.49
Target:E. coli
Link:P37690 - Function:Activator of the cell wall hydrolases AmiA and AmiB. Required for septal murein cleavage and daughter cell separation during cell division. In vitro, exhibits weak endoproteolytic activity on beta-casein.
- Antibacterial Activities
No MICs found on enzybiotics database
- Sequence
- MTRAVKPRRFAIRPIIYASVLSAGVLLCAFSAHADERDQLKSIQADIAAKERAVRQKQQQ RASLLAQLKKQEEAISEATRKLRETQNTLNQLNKQIDEMNASIAKLEQQKAAQERSLAAQ LDAAFRQGEHTGIQLILSGEESQRGQRLQAYFGYLNQARQETIAQLKQTREEVAMQRAEL EEKQSEQQTLLYEQRAQQAKLTQALNERKKTLAGLESSIQQGQQQLSELRANESRLRNSI ARAEAAAKARAEREAREAQAVRDRQKEATRKGTTYKPTESEKSLMSRTGGLGAPRGQAFW PVRGPTLHRYGEQLQGELRWKGMVIGASEGTEVKAIADGRVILADWLQGYGLVVVVEHGK GDMSLYGYNQSALVSVGSQVRAGQPIALVGSSGGQGRPSLYFEIRRQGQAVNPQPWLGR
- Domains
- 1 Name:Dup_hybrid_motif Interpro Link:IPR011055
- 2 Name:Peptidase_M23 Interpro Link:IPR016047
- Structures
No structs found on enzybiotics database
- Reference
- [1] Bernhardt T.G.,Dinh T.,Parzych K.R.,Uehara T.,
- Title:Daughter cell separation is controlled by cytokinetic ring-activated cell wall hydrolysis.
- Journal:EMBO J.,2010,(29):1412-1422 [PubMed:20300061]
- [2] Bernhardt T.G.,Dinh T.,Uehara T.,
- Title:LytM-domain factors are required for daughter cell separation and rapid ampicillin-induced lysis in Escherichia coli.
- Journal:J. Bacteriol.,2009,(191):5094-5107 [PubMed:19525345]
- [3] Isono K.,Fujita K.,Yamamoto Y.,Morooka N.,Hayashi K.,
- Title:Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.
- Journal:Mol. Syst. Biol.,2006,(2):0-0 [PubMed:16738553]
- [4] de Boer P.A.,Bernhardt T.G.,
- Title:Screening for synthetic lethal mutants in Escherichia coli and identification of EnvC (YibP) as a periplasmic septal ring factor with murein hydrolase activity.
- Journal:Mol. Microbiol.,2004,(52):1255-1269 [PubMed:15165230]
- [5] Yamamoto Y.,Park J.T.,Karibian D.,Narita S.,Hara H.,
- Title:Identification and characterization of the Escherichia coli envC gene encoding a periplasmic coiled-coil protein with putative peptidase activity.
- Journal:FEMS Microbiol. Lett.,2002,(212):229-236 [PubMed:12113939]
- [6] Hiraga S.,Wada C.,Maeda M.,Yamazoe M.,Ichimura T.,
- Title:Proteolytic activity of YibP protein in Escherichia coli.
- Journal:J. Bacteriol.,2002,(184):2595-2602 [PubMed:11976287]
- [7] Burland V.,Perna N.T.,Bloch C.A.,Plunkett G. III,Blattner F.R.,
- Title:The complete genome sequence of Escherichia coli K-12.
- Journal:Science,1997,(277):1453-1474 [MEDLINE:97426617]
- [8] Blattner F.R.,Plunkett G. III,Daniels D.L.,Burland V.,Sofia H.J.,
- Title:Analysis of the Escherichia coli genome. V. DNA sequence of the region from 76.0 to 81.5 minutes.
- Journal:Nucleic Acids Res.,1994,(22):2576-2586 [MEDLINE:94316500]